SCOPe 2.05: Domain d2xagb1: 2xag B:308-375

Lineage for d2xagb1 (2xag B:308-375)

1. Root: SCOPe 2.05

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (35 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.35: Demethylase interaction domain of CoREST [267603] (1 family)
   Includes N-terminal part of Pfam PF01448, ELM2 domain, which interacts with LSD1

5. Family h.1.35.1: Demethylase interaction domain of CoREST [267619] (1 protein)

6. Protein Demethylase interaction domain of CoREST [267660] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [267739] (21 PDB entries)

8. Domain d2xagb1: 2xag B:308-375 [264570]
   Other proteins in same PDB: d2xaga1, d2xaga2, d2xaga3, d2xagb2
   complexed with fad, tcf

Details for d2xagb1

PDB Entry: 2xag, 3.1 Å

PDB Description: crystal structure of lsd1-corest in complex with para-bromo-(-)-trans-2-phenylcyclopropyl-1-amine

PDB Compounds: (B:) rest corepressor 1

SCOPe Domain Sequences for d2xagb1:

Sequence; same for both SEQRES and ATOM records:

>d2xagb1 h.1.35.1 (B:308-375) Demethylase interaction domain of CoREST {Human (Homo sapiens) [TaxId: 9606]}
rkppkgmflsqedveavsanataattvlrqldmelvsvkrqiqnikqtnsalkekldggi
epyrlpev

Timeline for d2xagb1:

• d2xagb1 is new in SCOPe 2.05-stable
  
• d2xagb1 appears in SCOPe 2.06
  
• d2xagb1 appears in the current release, SCOPe 2.08