Lineage for d2xafa1 (2xaf A:171-273)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1720411Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1721218Family a.4.1.18: SWIRM domain [140222] (4 proteins)
    Pfam PF04433; contains extra N-terminal helix
  6. 1721219Protein Lysine-specific histone demethylase 1, LSD1 [140227] (1 species)
  7. 1721220Species Human (Homo sapiens) [TaxId:9606] [140228] (28 PDB entries)
    Uniprot O60341 169-279
  8. 1721243Domain d2xafa1: 2xaf A:171-273 [264562]
    Other proteins in same PDB: d2xafa2, d2xafa3, d2xafb1, d2xafb2
    complexed with fad, tcf

Details for d2xafa1

PDB Entry: 2xaf (more details), 3.25 Å

PDB Description: crystal structure of lsd1-corest in complex with para-bromo-(+)-cis-2-phenylcyclopropyl-1-amine
PDB Compounds: (A:) Lysine-specific histone demethylase 1

SCOPe Domain Sequences for d2xafa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xafa1 a.4.1.18 (A:171-273) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]}
psgvegaafqsrlphdrmtsqeaacfpdiisgpqqtqkvflfirnrtlqlwldnpkiqlt
featlqqleapynsdtvlvhrvhsylerhglinfgiykrikpl

SCOPe Domain Coordinates for d2xafa1:

Click to download the PDB-style file with coordinates for d2xafa1.
(The format of our PDB-style files is described here.)

Timeline for d2xafa1: