Lineage for d2x8jf_ (2x8j F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2114950Fold c.41: Subtilisin-like [52742] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3
  4. 2114951Superfamily c.41.1: Subtilisin-like [52743] (3 families) (S)
  5. 2114952Family c.41.1.1: Subtilases [52744] (14 protein domains)
  6. 2115138Protein automated matches [190073] (15 species)
    not a true protein
  7. 2115149Species Bacillus clausii [TaxId:79880] [267807] (2 PDB entries)
  8. 2115155Domain d2x8jf_: 2x8j F: [264561]
    automated match to d2xrma_
    complexed with 1pe, gol, na

Details for d2x8jf_

PDB Entry: 2x8j (more details), 1.56 Å

PDB Description: intracellular subtilisin precursor from b. clausii
PDB Compounds: (F:) intracellular subtilisin protease

SCOPe Domain Sequences for d2x8jf_:

Sequence, based on SEQRES records: (download)

>d2x8jf_ c.41.1.1 (F:) automated matches {Bacillus clausii [TaxId: 79880]}
rkfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdlae
riiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsgd
gsgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvcaa
gnegdgredtnefaypaayneviavgavdfdlrlsdftntneeidivapgvgikstylds
gyaelsgtamaaphvagalaliinlaedafkrslseteiyaqlvrratpigftaqaegng
fltldlveritgqft

Sequence, based on observed residues (ATOM records): (download)

>d2x8jf_ c.41.1.1 (F:) automated matches {Bacillus clausii [TaxId: 79880]}
rkfrlipykqvdkvsalsevpmgveiveapavwrasakgagqiigvidtgcqvdhpdlae
riiggvnlttdyggdetnfsdnnghgthvagtvaaaetgsgvvgvapkadlfiikalsgd
gsgemgwiakairyavdwrgpkgeqmriitmslggptdseelhdavkyavsnnvsvvcaa
gnnefaypaayneviavgavdfdlrlsdftntneeidivapgvgikstyldsgyaelsgt
amaaphvagalaliinlaedafkrslseteiyaqlvrratpigftaqaegngfltldlve
ritgqft

SCOPe Domain Coordinates for d2x8jf_:

Click to download the PDB-style file with coordinates for d2x8jf_.
(The format of our PDB-style files is described here.)

Timeline for d2x8jf_: