Lineage for d1nbme2 (1nbm E:9-81)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466323Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 466324Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 466325Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 466371Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 466374Species Cow (Bos taurus) [TaxId:9913] [88678] (12 PDB entries)
  8. 466394Domain d1nbme2: 1nbm E:9-81 [26456]
    Other proteins in same PDB: d1nbma1, d1nbma2, d1nbma3, d1nbmb1, d1nbmb2, d1nbmb3, d1nbmc1, d1nbmc2, d1nbmc3, d1nbmd1, d1nbmd3, d1nbme1, d1nbme3, d1nbmf1, d1nbmf3, d1nbmg_

Details for d1nbme2

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

SCOP Domain Sequences for d1nbme2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbme2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1nbme2:

Click to download the PDB-style file with coordinates for d1nbme2.
(The format of our PDB-style files is described here.)

Timeline for d1nbme2: