SCOP 1.59: Domain d1nbmc2: 1nbm C:19-94

Lineage for d1nbmc2 (1nbm C:19-94)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)

8. Domain d1nbmc2: 1nbm C:19-94 [26454]
   Other proteins in same PDB: d1nbma1, d1nbma3, d1nbmb1, d1nbmb3, d1nbmc1, d1nbmc3, d1nbmd1, d1nbmd3, d1nbme1, d1nbme3, d1nbmf1, d1nbmf3, d1nbmg_

Details for d1nbmc2

PDB Entry: 1nbm, 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

SCOP Domain Sequences for d1nbmc2:

Sequence; same for both SEQRES and ATOM records:

>d1nbmc2 b.49.1.1 (C:19-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
adtsvdleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgn
dklikegdivkrtgai

Timeline for d1nbmc2:

• d1nbmc2 first appeared (with stable ids) in SCOP 1.55
  
• d1nbmc2 appears in SCOP 1.57
  
• d1nbmc2 appears in SCOP 1.61
  
• d1nbmc2 appears in the current release, SCOPe 2.08