Lineage for d2wrya_ (2wry A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1790651Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1790652Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 1791051Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 1791052Protein automated matches [190764] (2 species)
    not a true protein
  7. 1791053Species Chicken (Gallus gallus) [TaxId:9031] [255980] (6 PDB entries)
  8. 1791054Domain d2wrya_: 2wry A: [264536]
    automated match to d3nj5a_

Details for d2wrya_

PDB Entry: 2wry (more details), 1.58 Å

PDB Description: crystal structure of chicken cytokine interleukin 1 beta
PDB Compounds: (A:) interleukin-1beta

SCOPe Domain Sequences for d2wrya_:

Sequence, based on SEQRES records: (download)

>d2wrya_ b.42.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
afrytrsqsfdifdinqkcfvlesptqlvalhlqgpsssqkvrlnialyrprgprgsagt
gqmpvalgikgyklymscvmsgteptlqleeadvmrdidsveltrfifyrldsptegttr
fesaafpgwfictslqprqpvgitnqpdqvniatyklsgr

Sequence, based on observed residues (ATOM records): (download)

>d2wrya_ b.42.1.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
afrytrsqsfdifdinqkcfvlesptqlvalhlqgpsssqkvrlnialyrpragtgqmpv
algikgyklymscvmsgteptlqleeadvmrdidsveltrfifyrldsptegttrfesaa
fpgwfictslqprqpvgitnqpdqvniatyklsgr

SCOPe Domain Coordinates for d2wrya_:

Click to download the PDB-style file with coordinates for d2wrya_.
(The format of our PDB-style files is described here.)

Timeline for d2wrya_: