Lineage for d2wjwa_ (2wjw A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143939Protein automated matches [190296] (11 species)
    not a true protein
  7. 2143963Species Human (Homo sapiens) [TaxId:9606] [189164] (3 PDB entries)
  8. 2143964Domain d2wjwa_: 2wjw A: [264535]
    automated match to d3h5va_
    complexed with act, cl, nag, so4

Details for d2wjwa_

PDB Entry: 2wjw (more details), 1.8 Å

PDB Description: crystal structure of the human ionotropic glutamate receptor glur2 atd region at 1.8 a resolution
PDB Compounds: (A:) Glutamate receptor 2

SCOPe Domain Sequences for d2wjwa_:

Sequence, based on SEQRES records: (download)

>d2wjwa_ c.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdemyrslfqdlelkke
rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
yddslvskfierwstleekeypgahtttikytsaltydavqvmteafrnlrkqrieisrr
gnagdclanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngpr
kigywsevdkmvvt

Sequence, based on observed residues (ATOM records): (download)

>d2wjwa_ c.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nsiqigglfprgadqeysafrvgmvqfstsefrltphidnlevansfavtnafcsqfsrg
vyaifgfydkksvntitsfcgtlhvsfitpsfptdgthpfviqmrpdlkgallslieyyq
wdkfaylydsdrglstlqavldsaaekkwqvtainvgninndkkdemyrslfqdlelkke
rrvildcerdkvndivdqvitigkhvkgyhyiianlgftdgdllkiqfgganvsgfqivd
yddslvskfierwstleekeypgahtttikytsaltydavqvmteafrnlrkqrieigdc
lanpavpwgqgveieralkqvqveglsgnikfdqngkrinytinimelktngprkigyws
evdkmvvt

SCOPe Domain Coordinates for d2wjwa_:

Click to download the PDB-style file with coordinates for d2wjwa_.
(The format of our PDB-style files is described here.)

Timeline for d2wjwa_: