Lineage for d2w2ra_ (2w2r A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2612684Fold d.213: VSV matrix protein [75403] (1 superfamily)
    beta-alpha(2)-beta(4)-alpha-beta(2); two layers: alpha/beta; bifurcated coiled beta-sheet: order of the first 5 strands: 23154
  4. 2612685Superfamily d.213.1: VSV matrix protein [75404] (2 families) (S)
    automatically mapped to Pfam PF06326
  5. 2612693Family d.213.1.0: automated matches [267624] (1 protein)
    not a true family
  6. 2612694Protein automated matches [267672] (1 species)
    not a true protein
  7. 2612695Species Vesicular stomatitis virus [TaxId:11276] [267806] (1 PDB entry)
  8. 2612696Domain d2w2ra_: 2w2r A: [264532]
    automated match to d4owrc_

Details for d2w2ra_

PDB Entry: 2w2r (more details), 1.83 Å

PDB Description: structure of the vesicular stomatitis virus matrix protein
PDB Compounds: (A:) matrix protein

SCOPe Domain Sequences for d2w2ra_:

Sequence, based on SEQRES records: (download)

>d2w2ra_ d.213.1.0 (A:) automated matches {Vesicular stomatitis virus [TaxId: 11276]}
lsndffgmedmdlydkdslryekfrfmlkmtvrsnkpfrsyddvtaavsqwdnsyigmvg
krpfykiialigsshlqatpavladlnqpeyyatltgrcflphrlglippmfnvsetfrk
pfnigiykgtldftftvsddesnekvphvweymnpkyqsqiqkeglkfglilskkatgtw
vldqlspfk

Sequence, based on observed residues (ATOM records): (download)

>d2w2ra_ d.213.1.0 (A:) automated matches {Vesicular stomatitis virus [TaxId: 11276]}
lsndffgmedmdslryekfrfmlkmtvrsnkpfrsyddvtaavsqwdnsyigmvgkrpfy
kiialigsshlqatpavladlnqpeyyatltgrcflphrlglippmfnvsetfrkpfnig
iykgtldftftvsddesnekvphvweymnpkyqsqiqkeglkfglilskkatgtwvldql
spfk

SCOPe Domain Coordinates for d2w2ra_:

Click to download the PDB-style file with coordinates for d2w2ra_.
(The format of our PDB-style files is described here.)

Timeline for d2w2ra_: