Lineage for d2vpob_ (2vpo B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163796Species Halomonas elongata [TaxId:2746] [255854] (3 PDB entries)
  8. 2163800Domain d2vpob_: 2vpo B: [264530]
    automated match to d3gyyb_
    complexed with 6cs, mg

Details for d2vpob_

PDB Entry: 2vpo (more details), 1.8 Å

PDB Description: high resolution structure of the periplasmic binding protein teaa from teaabc trap transporter of halomonas elongata in complex with hydroxyectoine
PDB Compounds: (B:) periplasmic substrate binding protein

SCOPe Domain Sequences for d2vpob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vpob_ c.94.1.0 (B:) automated matches {Halomonas elongata [TaxId: 2746]}
dnwryaheeyegdvqdvfaqafkgyvednsdhtvqvyrfgelgesddimeqtqngilqfv
nqspgftgslipsaqiffipylmptdmdtvleffdeskainemfpklyaehglellkmyp
egemvvtadepitspedfdnkkirtmtnpllaetykafgatptplpwgevygglqtgiid
gqenpifwiesgglyevspnltftshgwfttammanqdfyeglseedqqlvqdaadaayd
htiehikglseeslekikaasdevtvtrlndeqiqafkerapqveekfiemtgeqgqell
dqfkadlkavq

SCOPe Domain Coordinates for d2vpob_:

Click to download the PDB-style file with coordinates for d2vpob_.
(The format of our PDB-style files is described here.)

Timeline for d2vpob_: