Lineage for d1nbmb2 (1nbm B:24-94)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 15612Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 15613Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 15614Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 15615Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (3 species)
  7. 15619Species Cow (Bos taurus) [TaxId:9913] [50618] (7 PDB entries)
  8. 15645Domain d1nbmb2: 1nbm B:24-94 [26453]
    Other proteins in same PDB: d1nbma1, d1nbma3, d1nbmb1, d1nbmb3, d1nbmc1, d1nbmc3, d1nbmd1, d1nbmd3, d1nbme1, d1nbme3, d1nbmf1, d1nbmf3, d1nbmg_

Details for d1nbmb2

PDB Entry: 1nbm (more details), 3 Å

PDB Description: the structure of bovine f1-atpase covalently inhibited with 4-chloro-7-nitrobenzofurazan

SCOP Domain Sequences for d1nbmb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbmb2 b.49.1.1 (B:24-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOP Domain Coordinates for d1nbmb2:

Click to download the PDB-style file with coordinates for d1nbmb2.
(The format of our PDB-style files is described here.)

Timeline for d1nbmb2: