Lineage for d2vd6a_ (2vd6 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2337216Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2337217Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2337388Family a.127.1.0: automated matches [191431] (1 protein)
    not a true family
  6. 2337389Protein automated matches [190621] (24 species)
    not a true protein
  7. 2337426Species Human (Homo sapiens) [TaxId:9606] [256256] (5 PDB entries)
  8. 2337435Domain d2vd6a_: 2vd6 A: [264523]
    automated match to d4ffxc_
    complexed with 2sa, amp, cl, fum, gol

Details for d2vd6a_

PDB Entry: 2vd6 (more details), 2 Å

PDB Description: Human adenylosuccinate lyase in complex with its substrate N6-(1,2- Dicarboxyethyl)-AMP, and its products AMP and fumarate.
PDB Compounds: (A:) adenylosuccinate lyase

SCOPe Domain Sequences for d2vd6a_:

Sequence, based on SEQRES records: (download)

>d2vd6a_ a.127.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqe
mksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliil
rnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlq
nlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtyt
rkvdievlsvlaslgasvhkictdirllanlkemeepfekqqigssampykrnpmrserc
cslarhlmtlvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvv
ypkvierrirqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndli
eriqvdayfspihsqldhlldpssftgrasqqvqrfleeevypllkpyes

Sequence, based on observed residues (ATOM records): (download)

>d2vd6a_ a.127.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gdhgspdsyrsplasryaspemcfvfsdrykfrtwrqlwlwlaeaeqtlglpitdeqiqe
mksnlenidfkmaaeeekrlrhdvmahvhtfghccpkaagiihlgatscyvgdntdliil
rnaldlllpklarvisrladfakeraslptlgfthfqpaqlttvgkrcclwiqdlcmdlq
nlkrvrddlrfrgvkgttgtqasflqlfegddhkveqldkmvtekagfkrafiitgqtyt
rkvdievlsvlaslgasvhkictdirllanlkemeepfepykrnpmrserccslarhlmt
lvmdplqtasvqwfertlddsanrriclaeafltadtilntlqniseglvvypkvierri
rqelpfmateniimamvkaggsrqdchekirvlsqqaasvvkqeggdndlieriqvdayf
spihsqldhlldpssftgrasqqvqrfleeevypllkpyes

SCOPe Domain Coordinates for d2vd6a_:

Click to download the PDB-style file with coordinates for d2vd6a_.
(The format of our PDB-style files is described here.)

Timeline for d2vd6a_: