SCOPe 2.05: Domain d2v9qa2: 2v9q A:168-268

Lineage for d2v9qa2 (2v9q A:168-268)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d2v9qa2: 2v9q A:168-268 [264520]
   automated match to d2dm3a_
   complexed with hg

Details for d2v9qa2

PDB Entry: 2v9q, 2.5 Å

PDB Description: first and second ig domains from human robo1

PDB Compounds: (A:) roundabout homolog 1

SCOPe Domain Sequences for d2v9qa2:

Sequence; same for both SEQRES and ATOM records:

>d2v9qa2 b.1.1.0 (A:168-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lrddfrqnpsdvmvavgepavmecqpprghpeptiswkkdgsplddkderitirggklmi
tytrksdagkyvcvgtnmvgeresevaeltvlerpsfvkaa

Timeline for d2v9qa2:

• d2v9qa2 is new in SCOPe 2.05-stable
  
• d2v9qa2 appears in SCOPe 2.06
  
• d2v9qa2 appears in the current release, SCOPe 2.08