Lineage for d2v5ga_ (2v5g A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3011638Fold d.367: EscU C-terminal domain-like [160543] (1 superfamily)
    alpha-beta(3)-alpha-beta-alpha(2); 3 layers, a/b/a; mixed beta-sheet, order: 4123, strand 2 is antiparallel to the rest
  4. 3011639Superfamily d.367.1: EscU C-terminal domain-like [160544] (2 families) (S)
  5. 3011657Family d.367.1.0: automated matches [191577] (1 protein)
    not a true family
  6. 3011658Protein automated matches [191013] (4 species)
    not a true protein
  7. 3011665Species Yersinia enterocolitica [TaxId:630] [267805] (2 PDB entries)
  8. 3011667Domain d2v5ga_: 2v5g A: [264518]
    automated match to d2jlja_
    complexed with cl

Details for d2v5ga_

PDB Entry: 2v5g (more details), 2 Å

PDB Description: crystal structure of the mutated n263a yscu c-terminal domain
PDB Compounds: (A:) yscu

SCOPe Domain Sequences for d2v5ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2v5ga_ d.367.1.0 (A:) automated matches {Yersinia enterocolitica [TaxId: 630]}
kreykemegspeikskrrqfhqeiqsgnmrenvkrssvvvaapthiaigilykrgetplp
lvtfkytdaqvqtvrkiaeeegvpilqriplaralywdalvdhyipaeqieataevlrwl

SCOPe Domain Coordinates for d2v5ga_:

Click to download the PDB-style file with coordinates for d2v5ga_.
(The format of our PDB-style files is described here.)

Timeline for d2v5ga_: