![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.367: EscU C-terminal domain-like [160543] (1 superfamily) alpha-beta(3)-alpha-beta-alpha(2); 3 layers, a/b/a; mixed beta-sheet, order: 4123, strand 2 is antiparallel to the rest |
![]() | Superfamily d.367.1: EscU C-terminal domain-like [160544] (2 families) ![]() |
![]() | Family d.367.1.0: automated matches [191577] (1 protein) not a true family |
![]() | Protein automated matches [191013] (4 species) not a true protein |
![]() | Species Yersinia enterocolitica [TaxId:630] [267805] (2 PDB entries) |
![]() | Domain d2v5ga_: 2v5g A: [264518] automated match to d2jlja_ complexed with cl |
PDB Entry: 2v5g (more details), 2 Å
SCOPe Domain Sequences for d2v5ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v5ga_ d.367.1.0 (A:) automated matches {Yersinia enterocolitica [TaxId: 630]} kreykemegspeikskrrqfhqeiqsgnmrenvkrssvvvaapthiaigilykrgetplp lvtfkytdaqvqtvrkiaeeegvpilqriplaralywdalvdhyipaeqieataevlrwl
Timeline for d2v5ga_: