![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.0: automated matches [191325] (1 protein) not a true family |
![]() | Protein automated matches [190143] (42 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [255553] (4 PDB entries) |
![]() | Domain d2v1oc_: 2v1o C: [264514] automated match to d2qq2j_ complexed with coa |
PDB Entry: 2v1o (more details), 1.78 Å
SCOPe Domain Sequences for d2v1oc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v1oc_ d.38.1.0 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} gamrimrpddanvagnvhggtilkmieeagaiistrhcnsqngercvaalarvertdfls pmcigevahvsaeitytskhsvevqvhvmseniltgtkkltnkatlwyvplslknvdkvl evppivylrqeqeeegrkryeaqklerme
Timeline for d2v1oc_: