SCOPe 2.06: Domain d2ro5b_: 2ro5 B:

Lineage for d2ro5b_ (2ro5 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
   pseudobarrel; capped on both ends by alpha-helices

4. Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families)
   members of this superfamily are known or predicted to have DNA-binding function

5. Family b.129.1.3: AbrB N-terminal domain-like [54743] (3 proteins)
   dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
   automatically mapped to Pfam PF04014

6. Protein automated matches [267671] (1 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [267804] (1 PDB entry)

8. Domain d2ro5b_: 2ro5 B: [264509]
   automated match to d1z0ra_

Details for d2ro5b_

PDB Entry: 2ro5

PDB Description: RDC-refined solution structure of the N-terminal DNA recognition domain of the Bacillus subtilis transition-state regulator SpoVT

PDB Compounds: (B:) Stage V sporulation protein T

SCOPe Domain Sequences for d2ro5b_:

Sequence; same for both SEQRES and ATOM records:

>d2ro5b_ b.129.1.3 (B:) automated matches {Bacillus subtilis [TaxId: 1423]}
mkatgivrriddlgrvvipkeirrtlriregdpleifvdrdgevilkkyspisel

Timeline for d2ro5b_:

• d2ro5b_ first appeared in SCOPe 2.05
  
• d2ro5b_ appears in SCOPe 2.07
  
• d2ro5b_ appears in the current release, SCOPe 2.08