Lineage for d2ro5a_ (2ro5 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2412010Fold b.129: Double-split beta-barrel [89446] (2 superfamilies)
    pseudobarrel; capped on both ends by alpha-helices
  4. 2412011Superfamily b.129.1: AbrB/MazE/MraZ-like [89447] (3 families) (S)
    members of this superfamily are known or predicted to have DNA-binding function
  5. 2412043Family b.129.1.3: AbrB N-terminal domain-like [54743] (3 protein domains)
    dimeric fold similar to MazE; the DNA-binding site is similar to the conserved surface site of MraZ
    automatically mapped to Pfam PF04014
  6. 2412062Protein automated matches [267671] (1 species)
    not a true protein
  7. 2412063Species Bacillus subtilis [TaxId:1423] [267804] (1 PDB entry)
  8. 2412064Domain d2ro5a_: 2ro5 A: [264508]
    automated match to d1z0ra_

Details for d2ro5a_

PDB Entry: 2ro5 (more details)

PDB Description: RDC-refined solution structure of the N-terminal DNA recognition domain of the Bacillus subtilis transition-state regulator SpoVT
PDB Compounds: (A:) Stage V sporulation protein T

SCOPe Domain Sequences for d2ro5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ro5a_ b.129.1.3 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
mkatgivrriddlgrvvipkeirrtlriregdpleifvdrdgevilkkyspisel

SCOPe Domain Coordinates for d2ro5a_:

Click to download the PDB-style file with coordinates for d2ro5a_.
(The format of our PDB-style files is described here.)

Timeline for d2ro5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ro5b_