Lineage for d2rg7c_ (2rg7 C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912730Family c.92.2.0: automated matches [191548] (1 protein)
    not a true family
  6. 2912731Protein automated matches [190944] (40 species)
    not a true protein
  7. 2912830Species Shigella dysenteriae [TaxId:622] [267803] (2 PDB entries)
  8. 2912833Domain d2rg7c_: 2rg7 C: [264503]
    automated match to d4m7oa_

Details for d2rg7c_

PDB Entry: 2rg7 (more details), 2.05 Å

PDB Description: Apo- Crystal Structure of a Periplasmic Heme Binding Protein from Shigella dysenteriae
PDB Compounds: (C:) Periplasmic HEME binding protein

SCOPe Domain Sequences for d2rg7c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2rg7c_ c.92.2.0 (C:) automated matches {Shigella dysenteriae [TaxId: 622]}
aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd
svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq
inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk
sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr
iadvveslhqqlwpq

SCOPe Domain Coordinates for d2rg7c_:

Click to download the PDB-style file with coordinates for d2rg7c_.
(The format of our PDB-style files is described here.)

Timeline for d2rg7c_: