SCOPe 2.05: Domain d2rg7b_: 2rg7 B:

Lineage for d2rg7b_ (2rg7 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.2: "Helical backbone" metal receptor [53807] (5 families)
   contains a long alpha helical insertion in the interdomain linker

5. Family c.92.2.0: automated matches [191548] (1 protein)
   not a true family

6. Protein automated matches [190944] (28 species)
   not a true protein

7. Species Shigella dysenteriae [TaxId:622] [267803] (2 PDB entries)

8. Domain d2rg7b_: 2rg7 B: [264502]
   automated match to d4m7oa_

Details for d2rg7b_

PDB Entry: 2rg7, 2.05 Å

PDB Description: Apo- Crystal Structure of a Periplasmic Heme Binding Protein from Shigella dysenteriae

PDB Compounds: (B:) Periplasmic HEME binding protein

SCOPe Domain Sequences for d2rg7b_:

Sequence; same for both SEQRES and ATOM records:

>d2rg7b_ c.92.2.0 (B:) automated matches {Shigella dysenteriae [TaxId: 622]}
aerivvaggslteliyamgagervvgvdettsyppetaklphigywkqlssegilslrpd
svitwqdagpqivldqlraqkvnvvtlprvpatleqmyanirqlaktlqvpeqgdalvtq
inqrlervqqnvaakkapvkamfilsaggsapqvagkgsvadailslagaenvathqqyk
sysaesliaanpevivvtsqmvdgdinrlrsiagithtaawknqriitvdqnlilgmgpr
iadvveslhqqlwpq

Timeline for d2rg7b_:

• d2rg7b_ is new in SCOPe 2.05-stable
  
• d2rg7b_ appears in SCOPe 2.06
  
• d2rg7b_ appears in the current release, SCOPe 2.08