| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily) core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest |
Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) ![]() |
| Family c.43.1.0: automated matches [191456] (1 protein) not a true family |
| Protein automated matches [190703] (7 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [267774] (8 PDB entries) |
| Domain d2rcub1: 2rcu B:441-658 [264500] automated match to d1nm8a2 complexed with bog, buj |
PDB Entry: 2rcu (more details), 1.78 Å
SCOPe Domain Sequences for d2rcub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2rcub1 c.43.1.0 (B:441-658) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrte
tirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalr
ylatarglnlpelyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddw
igcnvssysgrnareflhcvqkcledifdalegkaikt
Timeline for d2rcub1: