SCOP 1.65: Domain d1bmfe2: 1bmf E:9-81

Lineage for d1bmfe2 (1bmf E:9-81)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88678] (10 PDB entries)

8. Domain d1bmfe2: 1bmf E:9-81 [26450]
   Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfa3, d1bmfb1, d1bmfb2, d1bmfb3, d1bmfc1, d1bmfc2, d1bmfc3, d1bmfd1, d1bmfd3, d1bmfe1, d1bmfe3, d1bmff1, d1bmff3, d1bmfg_

Details for d1bmfe2

PDB Entry: 1bmf, 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmfe2:

Sequence; same for both SEQRES and ATOM records:

>d1bmfe2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

Timeline for d1bmfe2:

• d1bmfe2 first appeared (with stable ids) in SCOP 1.55
  
• d1bmfe2 appears in SCOP 1.63
  
• d1bmfe2 appears in SCOP 1.67
  
• d1bmfe2 appears in the current release, SCOPe 2.08