Lineage for d1bmfe2 (1bmf E:9-81)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 299710Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 299711Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 299712Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 299752Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 299755Species Cow (Bos taurus) [TaxId:9913] [88678] (10 PDB entries)
  8. 299766Domain d1bmfe2: 1bmf E:9-81 [26450]
    Other proteins in same PDB: d1bmfa1, d1bmfa2, d1bmfa3, d1bmfb1, d1bmfb2, d1bmfb3, d1bmfc1, d1bmfc2, d1bmfc3, d1bmfd1, d1bmfd3, d1bmfe1, d1bmfe3, d1bmff1, d1bmff3, d1bmfg_

Details for d1bmfe2

PDB Entry: 1bmf (more details), 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

SCOP Domain Sequences for d1bmfe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bmfe2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1bmfe2:

Click to download the PDB-style file with coordinates for d1bmfe2.
(The format of our PDB-style files is described here.)

Timeline for d1bmfe2: