SCOPe 2.05: Domain d2rcua1: 2rcu A:441-658

Lineage for d2rcua1 (2rcu A:441-658)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
   core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest

4. Superfamily c.43.1: CoA-dependent acyltransferases [52777] (4 families)

5. Family c.43.1.0: automated matches [191456] (1 protein)
   not a true family

6. Protein automated matches [190703] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [267774] (8 PDB entries)

8. Domain d2rcua1: 2rcu A:441-658 [264499]
   automated match to d1nm8a2
   complexed with bog, buj

Details for d2rcua1

PDB Entry: 2rcu, 1.78 Å

PDB Description: crystal structure of rat carnitine palmitoyltransferase 2 in complex with r-3-(hexadecanoylamino)-4-(trimethylazaniumyl)butanoate

PDB Compounds: (A:) Carnitine O-palmitoyltransferase 2

SCOPe Domain Sequences for d2rcua1:

Sequence; same for both SEQRES and ATOM records:

>d2rcua1 c.43.1.0 (A:441-658) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lsidsiqfqrggkeflkkkqlspdavaqlafqmaflrqygqtvatyescstaafkhgrte
tirpasiftkrcseafvrdpskhsvgelqhmmaecskyhgqltkeaamgqgfdrhlyalr
ylatarglnlpelyldpayqqmnhnilststlnspavslggfapvvpdgfgiayavhddw
igcnvssysgrnareflhcvqkcledifdalegkaikt

Timeline for d2rcua1:

• d2rcua1 is new in SCOPe 2.05-stable
  
• d2rcua1 appears in SCOPe 2.06
  
• d2rcua1 appears in the current release, SCOPe 2.08