SCOPe 2.08: Domain d2qqob3: 2qqo B:434-593

Lineage for d2qqob3 (2qqo B:434-593)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.0: automated matches [191481] (1 protein)
   not a true family

6. Protein automated matches [190770] (51 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)

8. Domain d2qqob3: 2qqo B:434-593 [264489]
   Other proteins in same PDB: d2qqoa1, d2qqob1
   automated match to d2qqma2
   complexed with ca, edo, trs

Details for d2qqob3

PDB Entry: 2qqo, 2.3 Å

PDB Description: crystal structure of the a2b1b2 domains from human neuropilin-2

PDB Compounds: (B:) Neuropilin-2

SCOPe Domain Sequences for d2qqob3:

Sequence, based on SEQRES records:

>d2qqob3 b.18.1.0 (B:434-593) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg
tpktvkgviiqgarggdsitavearafvrkfkvsyslngkdweyiqdprtqqpklfegnm
hydtpdirrfdpipaqyvrvyperwspagigmrlevlgcd

Sequence, based on observed residues (ATOM records):

>d2qqob3 b.18.1.0 (B:434-593) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg
tpktvkgviiqgarggdsarafvrkfkvsyslngkdweyiqdprtqqpklfegnmhydtp
dirrfdpipaqyvrvyperwspagigmrlevlgcd

Timeline for d2qqob3:

• d2qqob3 first appeared in SCOPe 2.05
  
• d2qqob3 appears in SCOPe 2.07