Lineage for d2qqob3 (2qqo B:434-593)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775243Species Human (Homo sapiens) [TaxId:9606] [188939] (29 PDB entries)
  8. 2775298Domain d2qqob3: 2qqo B:434-593 [264489]
    Other proteins in same PDB: d2qqoa1, d2qqob1
    automated match to d2qqma2
    complexed with ca, edo, trs

Details for d2qqob3

PDB Entry: 2qqo (more details), 2.3 Å

PDB Description: crystal structure of the a2b1b2 domains from human neuropilin-2
PDB Compounds: (B:) Neuropilin-2

SCOPe Domain Sequences for d2qqob3:

Sequence, based on SEQRES records: (download)

>d2qqob3 b.18.1.0 (B:434-593) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg
tpktvkgviiqgarggdsitavearafvrkfkvsyslngkdweyiqdprtqqpklfegnm
hydtpdirrfdpipaqyvrvyperwspagigmrlevlgcd

Sequence, based on observed residues (ATOM records): (download)

>d2qqob3 b.18.1.0 (B:434-593) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csnmlgmlsgliadsqisasstqeylwspsaarlvssrsgwfpripqaqpgeewlqvdlg
tpktvkgviiqgarggdsarafvrkfkvsyslngkdweyiqdprtqqpklfegnmhydtp
dirrfdpipaqyvrvyperwspagigmrlevlgcd

SCOPe Domain Coordinates for d2qqob3:

Click to download the PDB-style file with coordinates for d2qqob3.
(The format of our PDB-style files is described here.)

Timeline for d2qqob3: