Lineage for d2qqob1 (2qqo B:148-268)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2777703Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2777704Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2777749Family b.23.1.0: automated matches [254288] (1 protein)
    not a true family
  6. 2777750Protein automated matches [254671] (1 species)
    not a true protein
  7. 2777751Species Human (Homo sapiens) [TaxId:9606] [255797] (4 PDB entries)
  8. 2777757Domain d2qqob1: 2qqo B:148-268 [264487]
    Other proteins in same PDB: d2qqoa2, d2qqoa3, d2qqob2, d2qqob3
    automated match to d2qqma3
    complexed with ca, edo, trs

Details for d2qqob1

PDB Entry: 2qqo (more details), 2.3 Å

PDB Description: crystal structure of the a2b1b2 domains from human neuropilin-2
PDB Compounds: (B:) Neuropilin-2

SCOPe Domain Sequences for d2qqob1:

Sequence, based on SEQRES records: (download)

>d2qqob1 b.23.1.0 (B:148-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dcsknftspngtiespgfpekyphnldctftilakpkmeiilqflifdlehdplqvgegd
ckydwldiwdgiphvgpligkycgtktpselrsstgilsltfhtdmavakdgfsaryylv
h

Sequence, based on observed residues (ATOM records): (download)

>d2qqob1 b.23.1.0 (B:148-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dcsknftspngtiespgfpekyphnldctftilakpkmeiilqflifdlehdckydwldi
wdgiphvgpligkycgtktpselrsstgilsltfhtdmavakdgfsaryylvh

SCOPe Domain Coordinates for d2qqob1:

Click to download the PDB-style file with coordinates for d2qqob1.
(The format of our PDB-style files is described here.)

Timeline for d2qqob1: