SCOPe 2.08: Domain d2qqob1: 2qqo B:148-268

Lineage for d2qqob1 (2qqo B:148-268)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.23: CUB-like [49853] (3 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families)
   automatically mapped to Pfam PF00431

5. Family b.23.1.0: automated matches [254288] (1 protein)
   not a true family

6. Protein automated matches [254671] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255797] (4 PDB entries)

8. Domain d2qqob1: 2qqo B:148-268 [264487]
   Other proteins in same PDB: d2qqoa2, d2qqoa3, d2qqob2, d2qqob3
   automated match to d2qqma3
   complexed with ca, edo, trs

Details for d2qqob1

PDB Entry: 2qqo, 2.3 Å

PDB Description: crystal structure of the a2b1b2 domains from human neuropilin-2

PDB Compounds: (B:) Neuropilin-2

SCOPe Domain Sequences for d2qqob1:

Sequence, based on SEQRES records:

>d2qqob1 b.23.1.0 (B:148-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dcsknftspngtiespgfpekyphnldctftilakpkmeiilqflifdlehdplqvgegd
ckydwldiwdgiphvgpligkycgtktpselrsstgilsltfhtdmavakdgfsaryylv
h

Sequence, based on observed residues (ATOM records):

>d2qqob1 b.23.1.0 (B:148-268) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dcsknftspngtiespgfpekyphnldctftilakpkmeiilqflifdlehdckydwldi
wdgiphvgpligkycgtktpselrsstgilsltfhtdmavakdgfsaryylvh

Timeline for d2qqob1:

• d2qqob1 first appeared in SCOPe 2.05
  
• d2qqob1 appears in SCOPe 2.07