SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2qjnd2 (2qjn D:112-402)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2086988Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2087392Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2087393Protein automated matches [226923] (72 species)
    not a true protein
  7. 2087758Species Novosphingobium aromaticivorans [TaxId:48935] [267802] (3 PDB entries)
  8. 2087766Domain d2qjnd2: 2qjn D:112-402 [264483]
    Other proteins in same PDB: d2qjna1, d2qjnb1, d2qjnc1, d2qjnd1
    automated match to d4il2a2
    complexed with kdg, mg

Details for d2qjnd2

PDB Entry: 2qjn (more details), 2 Å

PDB Description: Crystal structure of D-mannonate dehydratase from Novosphingobium aromaticivorans complexed with Mg and 2-keto-3-deoxy-D-gluconate
PDB Compounds: (D:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2qjnd2:

Sequence, based on SEQRES records: (download)

>d2qjnd2 c.1.11.0 (D:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgikdaygvgrgklyyepa
daslpsvtgwdtrkalnyvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyq
lfwledctpaenqeafrlvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagg
lthlrriadlaslyqvrtgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavf
phdywfekgelfvgetpghgvdideelaakypykpaylpvarledgtmwnw

Sequence, based on observed residues (ATOM records): (download)

>d2qjnd2 c.1.11.0 (D:112-402) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
rsrdgimvyghangsdiaetveavghyidmgykairaqtgvpgiaslpsvtgwdtrkaln
yvpklfeelrktygfdhhllhdghhrytpqeaanlgkmlepyqlfwledctpaenqeafr
lvrqhtvtplavgeifntiwdakdliqnqlidyiratvvgagglthlrriadlaslyqvr
tgchgatdlspvtmgcalhfdtwvpnfgiqeymrhteetdavfphdywfekgelfvgetp
ghgvdideelaakypykpaylpvarledgtmwnw

SCOPe Domain Coordinates for d2qjnd2:

Click to download the PDB-style file with coordinates for d2qjnd2.
(The format of our PDB-style files is described here.)

Timeline for d2qjnd2: