Lineage for d2qjmd1 (2qjm D:1-111)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948375Species Novosphingobium aromaticivorans [TaxId:48935] [267801] (3 PDB entries)
  8. 2948387Domain d2qjmd1: 2qjm D:1-111 [264474]
    Other proteins in same PDB: d2qjma2, d2qjmb2, d2qjmc2, d2qjmd2
    automated match to d4il2a1
    complexed with cs2, mg; mutant

Details for d2qjmd1

PDB Entry: 2qjm (more details), 2.2 Å

PDB Description: crystal structure of the k271e mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate
PDB Compounds: (D:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2qjmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2qjmd1 d.54.1.0 (D:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg

SCOPe Domain Coordinates for d2qjmd1:

Click to download the PDB-style file with coordinates for d2qjmd1.
(The format of our PDB-style files is described here.)

Timeline for d2qjmd1: