SCOPe 2.08: Domain d2qjmb1: 2qjm B:1-111

Lineage for d2qjmb1 (2qjm B:1-111)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:48935] [267801] (3 PDB entries)

8. Domain d2qjmb1: 2qjm B:1-111 [264470]
   Other proteins in same PDB: d2qjma2, d2qjmb2, d2qjmc2, d2qjmd2
   automated match to d4il2a1
   complexed with cs2, mg; mutant

Details for d2qjmb1

PDB Entry: 2qjm, 2.2 Å

PDB Description: crystal structure of the k271e mutant of mannonate dehydratase from novosphingobium aromaticivorans complexed with mg and d-mannonate

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2qjmb1:

Sequence; same for both SEQRES and ATOM records:

>d2qjmb1 d.54.1.0 (B:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg

Timeline for d2qjmb1:

• d2qjmb1 first appeared in SCOPe 2.05
  
• d2qjmb1 appears in SCOPe 2.07