SCOPe 2.04: Domain d1bmfb2: 1bmf B:24-94

Lineage for d1bmfb2 (1bmf B:24-94)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
   Uniprot P19483

8. Domain d1bmfb2: 1bmf B:24-94 [26447]
   Other proteins in same PDB: d1bmfa1, d1bmfa3, d1bmfb1, d1bmfb3, d1bmfc1, d1bmfc3, d1bmfd1, d1bmfd2, d1bmfd3, d1bmfe1, d1bmfe2, d1bmfe3, d1bmff1, d1bmff2, d1bmff3, d1bmfg_
   complexed with adp, anp, mg

Details for d1bmfb2

PDB Entry: 1bmf, 2.85 Å

PDB Description: bovine mitochondrial f1-atpase

PDB Compounds: (B:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1bmfb2:

Sequence; same for both SEQRES and ATOM records:

>d1bmfb2 b.49.1.1 (B:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

Timeline for d1bmfb2:

• d1bmfb2 first appeared (with stable ids) in SCOP 1.55
  
• d1bmfb2 appears in SCOPe 2.03
  
• d1bmfb2 appears in SCOPe 2.05
  
• d1bmfb2 appears in the current release, SCOPe 2.08