SCOPe 2.08: Domain d2qjjd1: 2qjj D:1-111

Lineage for d2qjjd1 (2qjj D:1-111)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Novosphingobium aromaticivorans [TaxId:48935] [267801] (3 PDB entries)

8. Domain d2qjjd1: 2qjj D:1-111 [264466]
   Other proteins in same PDB: d2qjja2, d2qjjb2, d2qjjc2, d2qjjd2
   automated match to d4il2a1
   complexed with mg

Details for d2qjjd1

PDB Entry: 2qjj, 1.8 Å

PDB Description: Crystal structure of D-Mannonate dehydratase from Novosphingobium aromaticivorans

PDB Compounds: (D:) Mandelate racemase/muconate lactonizing enzyme

SCOPe Domain Sequences for d2qjjd1:

Sequence; same for both SEQRES and ATOM records:

>d2qjjd1 d.54.1.0 (D:1-111) automated matches {Novosphingobium aromaticivorans [TaxId: 48935]}
mkitaarviitcpgrnfvtlkietdqgvygigdatlngrelsvvaylqehvapcligmdp
rriediwqyvyrgaywrrgpvtmraiaavdmalwdikakmagmplyqllgg

Timeline for d2qjjd1:

• d2qjjd1 first appeared in SCOPe 2.05
  
• d2qjjd1 appears in SCOPe 2.07