![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold |
![]() | Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) ![]() |
![]() | Family c.132.1.0: automated matches [227219] (1 protein) not a true family |
![]() | Protein automated matches [226958] (2 species) not a true protein |
![]() | Species Salinispora tropica [TaxId:369723] [225386] (6 PDB entries) |
![]() | Domain d2q6ob1: 2q6o B:3-163 [264456] Other proteins in same PDB: d2q6oa2, d2q6ob2 automated match to d2q6la1 complexed with cl, sam |
PDB Entry: 2q6o (more details), 2 Å
SCOPe Domain Sequences for d2q6ob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q6ob1 c.132.1.0 (B:3-163) automated matches {Salinispora tropica [TaxId: 369723]} hnliaflsdvgsadeahalckgvmygvapaativdithdvapfdvregalfladvphsfp ahtvicatvypetgtathtiavrnekgqllvgpnngllsfaldaspavechevlspdvmn qpvtptwygkdivaacaahlaagtdlaavgpridpkqivrl
Timeline for d2q6ob1: