Lineage for d2q6ob1 (2q6o B:3-163)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2923098Fold c.132: Bacterial fluorinating enzyme, N-terminal domain [102521] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 6 strands; order: 213546, strand 5 is antiparallel to the rest; topological similarity to the MogA-like family fold
  4. 2923099Superfamily c.132.1: Bacterial fluorinating enzyme, N-terminal domain [102522] (2 families) (S)
  5. 2923161Family c.132.1.0: automated matches [227219] (1 protein)
    not a true family
  6. 2923162Protein automated matches [226958] (2 species)
    not a true protein
  7. 2923163Species Salinispora tropica [TaxId:369723] [225386] (6 PDB entries)
  8. 2923172Domain d2q6ob1: 2q6o B:3-163 [264456]
    Other proteins in same PDB: d2q6oa2, d2q6ob2
    automated match to d2q6la1
    complexed with cl, sam

Details for d2q6ob1

PDB Entry: 2q6o (more details), 2 Å

PDB Description: sall-y70t with sam and cl
PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d2q6ob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2q6ob1 c.132.1.0 (B:3-163) automated matches {Salinispora tropica [TaxId: 369723]}
hnliaflsdvgsadeahalckgvmygvapaativdithdvapfdvregalfladvphsfp
ahtvicatvypetgtathtiavrnekgqllvgpnngllsfaldaspavechevlspdvmn
qpvtptwygkdivaacaahlaagtdlaavgpridpkqivrl

SCOPe Domain Coordinates for d2q6ob1:

Click to download the PDB-style file with coordinates for d2q6ob1.
(The format of our PDB-style files is described here.)

Timeline for d2q6ob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2q6ob2