Class b: All beta proteins [48724] (178 folds) |
Fold b.141: Bacterial fluorinating enzyme, C-terminal domain [101851] (1 superfamily) barrel, closed; n=7, S=10; greek-key topology; one overside connection |
Superfamily b.141.1: Bacterial fluorinating enzyme, C-terminal domain [101852] (2 families) |
Family b.141.1.0: automated matches [227220] (1 protein) not a true family |
Protein automated matches [226959] (4 species) not a true protein |
Species Salinispora tropica [TaxId:369723] [225387] (6 PDB entries) |
Domain d2q6oa2: 2q6o A:164-271 [264455] Other proteins in same PDB: d2q6oa1, d2q6ob1 automated match to d2q6ka2 complexed with cl, sam |
PDB Entry: 2q6o (more details), 2 Å
SCOPe Domain Sequences for d2q6oa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2q6oa2 b.141.1.0 (A:164-271) automated matches {Salinispora tropica [TaxId: 369723]} pyasaseveggirgevvridrafgnvwtnipthligsmlqdgerlevkiealsdtvlelp fcktfgevdegqpllylnsrgrlalglnqsnfiekwpvvpgdsitvsp
Timeline for d2q6oa2: