Lineage for d2p8ra_ (2p8r A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2918481Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2918897Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) (S)
  5. 2918898Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins)
    Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)
  6. 2918944Protein Splicing factor Prp8 C-terminal domain [267641] (2 species)
  7. 2918947Species Nematode (Caenorhabditis elegans) [TaxId:6239] [267700] (2 PDB entries)
  8. 2918948Domain d2p8ra_: 2p8r A: [264445]
    automated match to d2p87a_
    mutant

    has additional insertions and/or extensions that are not grouped together

Details for d2p8ra_

PDB Entry: 2p8r (more details), 2.1 Å

PDB Description: Crystal structure of the C-terminal domain of C. elegans pre-mRNA splicing factor Prp8 carrying R2303K mutant
PDB Compounds: (A:) Pre-mRNA-splicing factor Prp8

SCOPe Domain Sequences for d2p8ra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8ra_ c.97.3.1 (A:) Splicing factor Prp8 C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
srtewrvraisstnlhlrtqhiyvnsddvkdtgytyilpknilkkfitisdlrtqiagfm
ygvsppdnpqvkeircivlvpqtgshqqvnlptqlpdhellrdfeplgwmhtqpnelpql
spqdvtthaklltdniswdgektvmitcsftpgsvsltaykltpsgyewgkantdkgnnp
kgympthyekvqmllsdrflgyfmvpsngvwnynfqgqrwspamkfdvclsnpkeyyhed
hkpvhf

SCOPe Domain Coordinates for d2p8ra_:

Click to download the PDB-style file with coordinates for d2p8ra_.
(The format of our PDB-style files is described here.)

Timeline for d2p8ra_: