![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.3: JAB1/MPN domain [102712] (2 families) ![]() |
![]() | Family c.97.3.1: JAB1/MPN domain [102713] (8 proteins) Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1) |
![]() | Protein Splicing factor Prp8 C-terminal domain [267641] (2 species) |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [267700] (2 PDB entries) |
![]() | Domain d2p8ra_: 2p8r A: [264445] automated match to d2p87a_ mutant has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2p8r (more details), 2.1 Å
SCOPe Domain Sequences for d2p8ra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p8ra_ c.97.3.1 (A:) Splicing factor Prp8 C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} srtewrvraisstnlhlrtqhiyvnsddvkdtgytyilpknilkkfitisdlrtqiagfm ygvsppdnpqvkeircivlvpqtgshqqvnlptqlpdhellrdfeplgwmhtqpnelpql spqdvtthaklltdniswdgektvmitcsftpgsvsltaykltpsgyewgkantdkgnnp kgympthyekvqmllsdrflgyfmvpsngvwnynfqgqrwspamkfdvclsnpkeyyhed hkpvhf
Timeline for d2p8ra_: