Lineage for d2ov8a1 (2ov8 A:4-269)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114737Species Streptomyces toyocaensis [TaxId:55952] [267800] (4 PDB entries)
  8. 2114741Domain d2ov8a1: 2ov8 A:4-269 [264441]
    Other proteins in same PDB: d2ov8a2
    automated match to d3niba_

Details for d2ov8a1

PDB Entry: 2ov8 (more details), 2.58 Å

PDB Description: crystal structure of stal
PDB Compounds: (A:) StaL

SCOPe Domain Sequences for d2ov8a1:

Sequence, based on SEQRES records: (download)

>d2ov8a1 c.37.1.0 (A:4-269) automated matches {Streptomyces toyocaensis [TaxId: 55952]}
mcwiasypkagghwlrcmltsyvtgepvetwpgiqagvphlegllrdgeapsadpdeqvl
lathftadrpvlrfyrestakvvclirnprdamlslmrmkgippedveacrkiaetfiad
egfssvriwagegswpenirswtdsvhesfpnaavlavryedlrkdpegelwkvvdflel
ggrdgvadavanctlermremeerskllglettglmtrggkqlpfvgkggqrkslkfmgd
diekayadllhgetdfahyarlygya

Sequence, based on observed residues (ATOM records): (download)

>d2ov8a1 c.37.1.0 (A:4-269) automated matches {Streptomyces toyocaensis [TaxId: 55952]}
mcwiasypkagghwlrcmltsyvtgepvetwpgiqagvphlegllrdgeapsadpdeqvl
lathftadrpvlrfyrestakvvclirnprdamlslmrmkveacrkiaetfiadegfssv
riwagegswpenirswtdsvhesfpnaavlavryedlrkdpegelwkvvdflelggrdgv
adavanctlermremeerskllglettslkfmgddiekayadllhgetdfahyarlygya

SCOPe Domain Coordinates for d2ov8a1:

Click to download the PDB-style file with coordinates for d2ov8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ov8a1:

  • d2ov8a1 first appeared in SCOPe 2.05, called d2ov8a_

View in 3D
Domains from same chain:
(mouse over for more information)
d2ov8a2