| Class b: All beta proteins [48724] (126 folds) |
| Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies) barrel, closed; n=6, S=8; greek-key |
Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) ![]() |
| Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins) 6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?) |
| Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species) |
| Species Cow (Bos taurus) [TaxId:9913] [88678] (10 PDB entries) |
| Domain d1e1re2: 1e1r E:9-81 [26444] Other proteins in same PDB: d1e1ra1, d1e1ra2, d1e1ra3, d1e1rb1, d1e1rb2, d1e1rb3, d1e1rc1, d1e1rc2, d1e1rc3, d1e1rd1, d1e1rd3, d1e1re1, d1e1re3, d1e1rf1, d1e1rf3, d1e1rg_ |
PDB Entry: 1e1r (more details), 2.5 Å
SCOP Domain Sequences for d1e1re2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e1re2 b.49.1.1 (E:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap
Timeline for d1e1re2: