| Class g: Small proteins [56992] (100 folds) |
| Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily) dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888) |
Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) ![]() |
| Family g.85.1.1: MYND zinc finger [144233] (4 proteins) Pfam PF01753 |
| Protein automated matches [254618] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255523] (3 PDB entries) |
| Domain d2od1a_: 2od1 A: [264439] automated match to d2odda_ complexed with zn |
PDB Entry: 2od1 (more details)
SCOPe Domain Sequences for d2od1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2od1a_ g.85.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dssescwncgrkasetcsgcntarycgsfcqhkdwekhhhicgqtlqaqq
Timeline for d2od1a_: