Lineage for d2od1a_ (2od1 A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038778Fold g.85: HIT/MYND zinc finger-like [144231] (1 superfamily)
    dimetal(zinc)-bound alpha+beta fold; structural similarity to members of the Cysteine-rich domain fold (57888)
  4. 3038779Superfamily g.85.1: HIT/MYND zinc finger-like [144232] (2 families) (S)
  5. 3038780Family g.85.1.1: MYND zinc finger [144233] (4 proteins)
    Pfam PF01753
  6. 3038792Protein automated matches [254618] (1 species)
    not a true protein
  7. 3038793Species Human (Homo sapiens) [TaxId:9606] [255523] (3 PDB entries)
  8. 3038796Domain d2od1a_: 2od1 A: [264439]
    automated match to d2odda_
    complexed with zn

Details for d2od1a_

PDB Entry: 2od1 (more details)

PDB Description: solution structure of the mynd domain from human aml1-eto
PDB Compounds: (A:) Protein CBFA2T1

SCOPe Domain Sequences for d2od1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2od1a_ g.85.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dssescwncgrkasetcsgcntarycgsfcqhkdwekhhhicgqtlqaqq

SCOPe Domain Coordinates for d2od1a_:

Click to download the PDB-style file with coordinates for d2od1a_.
(The format of our PDB-style files is described here.)

Timeline for d2od1a_: