Lineage for d2obcb2 (2obc B:147-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904195Species Escherichia coli [TaxId:83333] [267798] (11 PDB entries)
  8. 2904208Domain d2obcb2: 2obc B:147-367 [264438]
    Other proteins in same PDB: d2obca1, d2obca3, d2obcb1, d2obcb3
    automated match to d2b3za1
    complexed with rp5

Details for d2obcb2

PDB Entry: 2obc (more details), 3 Å

PDB Description: the crystal structure of ribd from escherichia coli in complex with a substrate analogue, ribose 5-phosphate (beta form), bound to the active site of the reductase domain
PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2obcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2obcb2 c.71.1.0 (B:147-367) automated matches {Escherichia coli [TaxId: 83333]}
pyiqlklgasldgrtamasgesqwitspqarrdvqllraqshailtssatvladdpaltv
rwseldeqtqalypqqnlrqpirividsqnrvtpvhrivqqpgetwfartqedsrewpet
vrtllipehkghldlvvlmmqlgkqqinsiwveagptlagallqaglvdelivyiapkll
gsdarglctlpglekladapqfkfkeirhvgpdvclhlvga

SCOPe Domain Coordinates for d2obcb2:

Click to download the PDB-style file with coordinates for d2obcb2.
(The format of our PDB-style files is described here.)

Timeline for d2obcb2: