![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies) core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest |
![]() | Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) ![]() contains extra C-terminal strand 5, order 21345 |
![]() | Family c.97.1.0: automated matches [191471] (1 protein) not a true family |
![]() | Protein automated matches [190746] (16 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83333] [267797] (2 PDB entries) |
![]() | Domain d2obcb1: 2obc B:2-146 [264437] Other proteins in same PDB: d2obca2, d2obca3, d2obcb2, d2obcb3 automated match to d2b3za2 complexed with rp5 |
PDB Entry: 2obc (more details), 3 Å
SCOPe Domain Sequences for d2obcb1:
Sequence, based on SEQRES records: (download)
>d2obcb1 c.97.1.0 (B:2-146) automated matches {Escherichia coli [TaxId: 83333]} qdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevhalrmage kakgatayvtlepcshhgrtppccdaliaagvarvvasmqdpnpqvagrglyrlqqagid vshglmmseaeqlnkgflkrmrtgf
>d2obcb1 c.97.1.0 (B:2-146) automated matches {Escherichia coli [TaxId: 83333]} qdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevhalrmage kakgatayvtlepcsdaliaagvarvvasmqdpnqvagrglyrlqqagidvshglmmsea eqlnkgflkrmrtgf
Timeline for d2obcb1: