SCOPe 2.05: Domain d2obcb1: 2obc B:-4-146

Lineage for d2obcb1 (2obc B:-4-146)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (11 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [267797] (2 PDB entries)

8. Domain d2obcb1: 2obc B:-4-146 [264437]
   Other proteins in same PDB: d2obca2, d2obcb2
   automated match to d2b3za2
   complexed with rp5

Details for d2obcb1

PDB Entry: 2obc, 3 Å

PDB Description: the crystal structure of ribd from escherichia coli in complex with a substrate analogue, ribose 5-phosphate (beta form), bound to the active site of the reductase domain

PDB Compounds: (B:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2obcb1:

Sequence, based on SEQRES records:

>d2obcb1 c.97.1.0 (B:-4-146) automated matches {Escherichia coli [TaxId: 83333]}
tlyiqgqdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevha
lrmagekakgatayvtlepcshhgrtppccdaliaagvarvvasmqdpnpqvagrglyrl
qqagidvshglmmseaeqlnkgflkrmrtgf

Sequence, based on observed residues (ATOM records):

>d2obcb1 c.97.1.0 (B:-4-146) automated matches {Escherichia coli [TaxId: 83333]}
tlyiqgqdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevha
lrmagekakgatayvtlepcsdaliaagvarvvasmqdpnqvagrglyrlqqagidvshg
lmmseaeqlnkgflkrmrtgf

Timeline for d2obcb1:

• d2obcb1 is new in SCOPe 2.05-stable
  
• d2obcb1 appears in SCOPe 2.06
  
• d2obcb1 appears in the current release, SCOPe 2.08