Lineage for d2obca1 (2obc A:2-146)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2525733Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 2525734Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 2526065Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 2526066Protein automated matches [190746] (16 species)
    not a true protein
  7. 2526079Species Escherichia coli [TaxId:83333] [267797] (2 PDB entries)
  8. 2526080Domain d2obca1: 2obc A:2-146 [264435]
    Other proteins in same PDB: d2obca2, d2obca3, d2obcb2, d2obcb3
    automated match to d2b3za2
    complexed with rp5

Details for d2obca1

PDB Entry: 2obc (more details), 3 Å

PDB Description: the crystal structure of ribd from escherichia coli in complex with a substrate analogue, ribose 5-phosphate (beta form), bound to the active site of the reductase domain
PDB Compounds: (A:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2obca1:

Sequence, based on SEQRES records: (download)

>d2obca1 c.97.1.0 (A:2-146) automated matches {Escherichia coli [TaxId: 83333]}
qdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevhalrmage
kakgatayvtlepcshhgrtppccdaliaagvarvvasmqdpnpqvagrglyrlqqagid
vshglmmseaeqlnkgflkrmrtgf

Sequence, based on observed residues (ATOM records): (download)

>d2obca1 c.97.1.0 (A:2-146) automated matches {Escherichia coli [TaxId: 83333]}
qdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevhalrmage
kakgatayvtlepcpccdaliaagvarvvasmqdpnqvagrglyrlqqagidvshglmms
eaeqlnkgflkrmrtgf

SCOPe Domain Coordinates for d2obca1:

Click to download the PDB-style file with coordinates for d2obca1.
(The format of our PDB-style files is described here.)

Timeline for d2obca1: