Lineage for d2obca1 (2obc A:-4-146)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1882436Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
    core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest
  4. 1882437Superfamily c.97.1: Cytidine deaminase-like [53927] (6 families) (S)
    contains extra C-terminal strand 5, order 21345
  5. 1882645Family c.97.1.0: automated matches [191471] (1 protein)
    not a true family
  6. 1882646Protein automated matches [190746] (11 species)
    not a true protein
  7. 1882654Species Escherichia coli [TaxId:83333] [267797] (2 PDB entries)
  8. 1882655Domain d2obca1: 2obc A:-4-146 [264435]
    Other proteins in same PDB: d2obca2, d2obcb2
    automated match to d2b3za2
    complexed with rp5

Details for d2obca1

PDB Entry: 2obc (more details), 3 Å

PDB Description: the crystal structure of ribd from escherichia coli in complex with a substrate analogue, ribose 5-phosphate (beta form), bound to the active site of the reductase domain
PDB Compounds: (A:) Riboflavin biosynthesis protein ribD

SCOPe Domain Sequences for d2obca1:

Sequence, based on SEQRES records: (download)

>d2obca1 c.97.1.0 (A:-4-146) automated matches {Escherichia coli [TaxId: 83333]}
tlyiqgqdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevha
lrmagekakgatayvtlepcshhgrtppccdaliaagvarvvasmqdpnpqvagrglyrl
qqagidvshglmmseaeqlnkgflkrmrtgf

Sequence, based on observed residues (ATOM records): (download)

>d2obca1 c.97.1.0 (A:-4-146) automated matches {Escherichia coli [TaxId: 83333]}
tlyiqgqdeyymaralklaqrgrftthpnpnvgcvivkdgeivgegyhqragephaevha
lrmagekakgatayvtlepcpccdaliaagvarvvasmqdpnqvagrglyrlqqagidvs
hglmmseaeqlnkgflkrmrtgf

SCOPe Domain Coordinates for d2obca1:

Click to download the PDB-style file with coordinates for d2obca1.
(The format of our PDB-style files is described here.)

Timeline for d2obca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2obca2