SCOPe 2.05: Domain d2o96b_: 2o96 B:

Lineage for d2o96b_ (2o96 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.3: JAB1/MPN domain [102712] (2 families)

5. Family c.97.3.1: JAB1/MPN domain [102713] (6 proteins)
   Pfam PF01398; Pfam PF14464; synonyms Mov34, PAD-1. PubMed 17559875 asserts homology to (c.97.1)

6. Protein Mov34 [267640] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [267699] (2 PDB entries)

8. Domain d2o96b_: 2o96 B: [264434]
   automated match to d2o95a_

Details for d2o96b_

PDB Entry: 2o96, 3 Å

PDB Description: Crystal Structure of the Metal-Free Dimeric Human Mov34 MPN domain (residues 1-177)

PDB Compounds: (B:) 26S proteasome non-ATPase regulatory subunit 7

SCOPe Domain Sequences for d2o96b_:

Sequence, based on SEQRES records:

>d2o96b_ c.97.3.1 (B:) Mov34 {Human (Homo sapiens) [TaxId: 9606]}
mpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfde
ddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpnsv
lviidvkpkdlglpteayisveevhddgtptsktfehvtseigaeeae

Sequence, based on observed residues (ATOM records):

>d2o96b_ c.97.3.1 (B:) Mov34 {Human (Homo sapiens) [TaxId: 9606]}
mpelavqkvvvhplvllsvvdhfnrigkvgnqkrvvgvllgswqkkvldvsnsfavpfde
ddkddsvwfldhdylenmygmfkkvnarerivgwyhtgpklhkndiainelmkrycpnsv
lviidvkpkdglpteayisveeptsktfehvtseigaeeae

Timeline for d2o96b_:

• d2o96b_ is new in SCOPe 2.05-stable
  
• d2o96b_ appears in SCOPe 2.06
  
• d2o96b_ appears in the current release, SCOPe 2.08