Lineage for d2o2ja_ (2o2j A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2139771Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 protein domains)
  6. 2139947Protein Tryptophan synthase, beta-subunit [53688] (4 species)
  7. 2139948Species Mycobacterium tuberculosis [TaxId:1773] [267796] (2 PDB entries)
  8. 2139951Domain d2o2ja_: 2o2j A: [264424]
    automated match to d1wdwb_

Details for d2o2ja_

PDB Entry: 2o2j (more details), 2.56 Å

PDB Description: mycobacterium tuberculosis tryptophan synthase beta chain dimer (apoform)
PDB Compounds: (A:) tryptophan synthase beta chain

SCOPe Domain Sequences for d2o2ja_:

Sequence, based on SEQRES records: (download)

>d2o2ja_ c.79.1.1 (A:) Tryptophan synthase, beta-subunit {Mycobacterium tuberculosis [TaxId: 1773]}
yvpealmavieevtaayqkervsqdflddldrlqanyagrpsplyeatrlsqhagsarif
lkredlnhtgshkinnvlgqallarrmgktrviaetgagqhgvatatacallgldcviym
ggidtarqalnvarmrllgaevvavqtgsktlkdaineafrdwvanadntyycfgtaagp
hpfptmvrdfqriigmearvqiqgqagrlpdavvacvgggsnaigifhaflddpgvrlvg
feaagdgvetgrhaatftagspgafhgsfsyllqdedgqtieshsisagldypgvgpeha
wlkeagrvdyrpitdseamdafgllcrmegiipaiesahavagalklgvelgrgavivvn
lsgrgdkdvetaakwf

Sequence, based on observed residues (ATOM records): (download)

>d2o2ja_ c.79.1.1 (A:) Tryptophan synthase, beta-subunit {Mycobacterium tuberculosis [TaxId: 1773]}
yvpealmavieevtaayqkervsqdflddldrlqanyagrpsplyeatrlsqhagsarif
lkredlnhtgshkinnvlgqallarrmgktrviaetgagqhgvatatacallgldcviym
ggidtarqalnvarmrllgaevvavqtgsktlkdaineafrdwvanadntyycfgtaagp
hpfptmvrdfqriigmearvqiqgqagrlpdavvacvgggsnaigifhaflddpgvrlvg
feaagrvdyrpitdseamdafgllcrmegiipaiesahavagalklgvelgrgavivvnl
sgrgdkdvetaakwf

SCOPe Domain Coordinates for d2o2ja_:

Click to download the PDB-style file with coordinates for d2o2ja_.
(The format of our PDB-style files is described here.)

Timeline for d2o2ja_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2o2jb_