Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.1: FKBP-like [54534] (4 families) |
Family d.26.1.0: automated matches [191631] (1 protein) not a true family |
Protein automated matches [191162] (23 species) not a true protein |
Species Escherichia coli [TaxId:1403831] [256440] (3 PDB entries) |
Domain d2mlza2: 2mlz A:132-247 [264413] Other proteins in same PDB: d2mlza1, d2mlza3 automated match to d1w26a3 |
PDB Entry: 2mlz (more details)
SCOPe Domain Sequences for d2mlza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mlza2 d.26.1.0 (A:132-247) automated matches {Escherichia coli [TaxId: 1403831]} vtdadvdgmldtlrkqqatwkekdgaveaedrvtidftgsvdgeefeggkasdfvlamgq grmipgfedgikghkageeftidvtfpeeyhaenlkgkaakfainlkkveerelpe
Timeline for d2mlza2: