SCOPe 2.05: Domain d1e1rb2: 1e1r B:24-94

Lineage for d1e1rb2 (1e1r B:24-94)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (2 families)
   automatically mapped to Pfam PF02874

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

6. Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [88673] (15 PDB entries)
   Uniprot P19483

8. Domain d1e1rb2: 1e1r B:24-94 [26441]
   Other proteins in same PDB: d1e1ra1, d1e1ra3, d1e1rb1, d1e1rb3, d1e1rc1, d1e1rc3, d1e1rd1, d1e1rd2, d1e1rd3, d1e1re1, d1e1re2, d1e1re3, d1e1rf1, d1e1rf2, d1e1rf3, d1e1rg_
   complexed with adp, af3, anp, mg, po4

Details for d1e1rb2

PDB Entry: 1e1r, 2.5 Å

PDB Description: bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride

PDB Compounds: (B:) bovine mitochondrial f1-ATPase

SCOPe Domain Sequences for d1e1rb2:

Sequence; same for both SEQRES and ATOM records:

>d1e1rb2 b.49.1.1 (B:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

Timeline for d1e1rb2:

• d1e1rb2 first appeared (with stable ids) in SCOP 1.55
  
• d1e1rb2 appears in SCOPe 2.04
  
• d1e1rb2 appears in SCOPe 2.06
  
• d1e1rb2 appears in the current release, SCOPe 2.08