Lineage for d2mlya1 (2mly A:1-131)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3008569Fold d.241: Ribosome binding domain-like [100965] (2 superfamilies)
    beta-(2)-alpha(2)-beta(2); 2 layers: beta/alpha; antiparallel beta-sheet: order 1243; topological similarity to the common core of ribosomal proteins L23 and L15e
  4. 3008581Superfamily d.241.2: Trigger factor ribosome-binding domain [102735] (2 families) (S)
    automatically mapped to Pfam PF05697
  5. 3008596Family d.241.2.0: automated matches [256436] (1 protein)
    not a true family
  6. 3008597Protein automated matches [256437] (3 species)
    not a true protein
  7. 3008598Species Escherichia coli [TaxId:1403831] [256438] (3 PDB entries)
  8. 3008601Domain d2mlya1: 2mly A:1-131 [264409]
    Other proteins in same PDB: d2mlya2, d2mlya3
    automated match to d1w26a2

Details for d2mlya1

PDB Entry: 2mly (more details)

PDB Description: NMR structure of E. coli Trigger Factor in complex with unfolded PhoA1-150
PDB Compounds: (A:) Trigger Factor

SCOPe Domain Sequences for d2mlya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mlya1 d.241.2.0 (A:1-131) automated matches {Escherichia coli [TaxId: 1403831]}
mqvsvettqglgrrvtitiaadsietavkselvnvakkvridgfrkgkvpmnivaqryga
svrqdvlgdlmsrnfidaiikekinpagaptyvpgeyklgedftysvefevypevelqgl
eaievekpive

SCOPe Domain Coordinates for d2mlya1:

Click to download the PDB-style file with coordinates for d2mlya1.
(The format of our PDB-style files is described here.)

Timeline for d2mlya1: