Lineage for d2mjua2 (2mju A:445-531)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952339Protein automated matches [190332] (5 species)
    not a true protein
  7. 2952350Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)
  8. 2952430Domain d2mjua2: 2mju A:445-531 [264408]
    automated match to d2adca2

Details for d2mjua2

PDB Entry: 2mju (more details)

PDB Description: Solution structure of a C terminal fragment of the neuronal isoform of the polypyrimidine tract binding protein (nPTB)
PDB Compounds: (A:) polypyrimidine tract-binding protein 2

SCOPe Domain Sequences for d2mjua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mjua2 d.58.7.1 (A:445-531) automated matches {Human (Homo sapiens) [TaxId: 9606]}
knfqnifppsatlhlsnippsvaeedlrtlfantggtvkafkffqdhkmallqmatveea
iqalidlhnynlgenhhlrvsfsksti

SCOPe Domain Coordinates for d2mjua2:

Click to download the PDB-style file with coordinates for d2mjua2.
(The format of our PDB-style files is described here.)

Timeline for d2mjua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2mjua1