Lineage for d1e1ra2 (1e1r A:24-94)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 466323Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 466324Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 466325Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 466326Protein F1 ATP synthase alpha subunit, domain 1 [88672] (4 species)
  7. 466329Species Cow (Bos taurus) [TaxId:9913] [88673] (12 PDB entries)
  8. 466342Domain d1e1ra2: 1e1r A:24-94 [26440]
    Other proteins in same PDB: d1e1ra1, d1e1ra3, d1e1rb1, d1e1rb3, d1e1rc1, d1e1rc3, d1e1rd1, d1e1rd2, d1e1rd3, d1e1re1, d1e1re2, d1e1re3, d1e1rf1, d1e1rf2, d1e1rf3, d1e1rg_

Details for d1e1ra2

PDB Entry: 1e1r (more details), 2.5 Å

PDB Description: bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride

SCOP Domain Sequences for d1e1ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e1ra2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

SCOP Domain Coordinates for d1e1ra2:

Click to download the PDB-style file with coordinates for d1e1ra2.
(The format of our PDB-style files is described here.)

Timeline for d1e1ra2: