SCOP 1.63: Domain d1e1ra2: 1e1r A:24-94

Lineage for d1e1ra2 (1e1r A:24-94)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
   barrel, closed; n=6, S=8; greek-key

4. Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family)

5. Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)

6. Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
   6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)

7. Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)

8. Domain d1e1ra2: 1e1r A:24-94 [26440]
   Other proteins in same PDB: d1e1ra1, d1e1ra3, d1e1rb1, d1e1rb3, d1e1rc1, d1e1rc3, d1e1rd1, d1e1rd3, d1e1re1, d1e1re3, d1e1rf1, d1e1rf3, d1e1rg_

Details for d1e1ra2

PDB Entry: 1e1r, 2.5 Å

PDB Description: bovine mitochondrial f1-atpase inhibited by mg2+adp and aluminium fluoride

SCOP Domain Sequences for d1e1ra2:

Sequence; same for both SEQRES and ATOM records:

>d1e1ra2 b.49.1.1 (A:24-94) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
dleetgrvlsigdgiarvhglrnvqaeemvefssglkgmslnlepdnvgvvvfgndklik
egdivkrtgai

Timeline for d1e1ra2:

• d1e1ra2 first appeared (with stable ids) in SCOP 1.55
  
• d1e1ra2 appears in SCOP 1.61
  
• d1e1ra2 appears in SCOP 1.65
  
• d1e1ra2 appears in the current release, SCOPe 2.08