Lineage for d2mfcc_ (2mfc C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825104Fold b.151: CsrA-like [117129] (1 superfamily)
    sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)
  4. 2825105Superfamily b.151.1: CsrA-like [117130] (2 families) (S)
  5. 2825106Family b.151.1.1: CsrA-like [117131] (2 proteins)
    Pfam PF02599
  6. 2825114Protein automated matches [190528] (4 species)
    not a true protein
  7. 2825124Species Pseudomonas fluorescens [TaxId:294] [255284] (6 PDB entries)
  8. 2825128Domain d2mfcc_: 2mfc C: [264393]
    automated match to d2mf0a_
    protein/RNA complex

Details for d2mfcc_

PDB Entry: 2mfc (more details)

PDB Description: Csr/Rsm protein-RNA recognition - A molecular affinity ruler: RsmZ(SL1)/RsmE(dimer) 2:1 complex
PDB Compounds: (C:) carbon storage regulator homolog

SCOPe Domain Sequences for d2mfcc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mfcc_ b.151.1.1 (C:) automated matches {Pseudomonas fluorescens [TaxId: 294]}
mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapd

SCOPe Domain Coordinates for d2mfcc_:

Click to download the PDB-style file with coordinates for d2mfcc_.
(The format of our PDB-style files is described here.)

Timeline for d2mfcc_:

2825128
d2mfcc_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d2mfca_