Lineage for d2mf1f_ (2mf1 F:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2825104Fold b.151: CsrA-like [117129] (1 superfamily)
    sandwich; 10 strands in 2 sheets; intertwined dimer (segment-swapped, 5-stranded greek-key sandwich?)
  4. 2825105Superfamily b.151.1: CsrA-like [117130] (2 families) (S)
  5. 2825106Family b.151.1.1: CsrA-like [117131] (2 proteins)
    Pfam PF02599
  6. 2825114Protein automated matches [190528] (4 species)
    not a true protein
  7. 2825137Species Pseudomonas protegens [TaxId:220664] [256427] (2 PDB entries)
  8. 2825149Domain d2mf1f_: 2mf1 F: [264391]
    automated match to d2mf0a_
    protein/RNA complex

Details for d2mf1f_

PDB Entry: 2mf1 (more details)

PDB Description: Structural basis of the non-coding RNA RsmZ acting as protein sponge: Conformer R of RsmZ(1-72)/RsmE(dimer) 1to3 complex
PDB Compounds: (F:) carbon storage regulator homolog

SCOPe Domain Sequences for d2mf1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mf1f_ b.151.1.1 (F:) automated matches {Pseudomonas protegens [TaxId: 220664]}
mliltrkvgesinigddititilgvsgqqvriginapkdvavhreeiyqriqagltapd

SCOPe Domain Coordinates for d2mf1f_:

Click to download the PDB-style file with coordinates for d2mf1f_.
(The format of our PDB-style files is described here.)

Timeline for d2mf1f_: