Lineage for d1e79f2 (1e79 F:9-81)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 61155Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (2 superfamilies)
  4. 61156Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 61157Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (1 protein)
  6. 61158Protein N-terminal domain of alpha and beta subunits of F1 ATP synthase [50617] (4 species)
  7. 61162Species Cow (Bos taurus) [TaxId:9913] [50618] (9 PDB entries)
  8. 61168Domain d1e79f2: 1e79 F:9-81 [26439]
    Other proteins in same PDB: d1e79a1, d1e79a3, d1e79b1, d1e79b3, d1e79c1, d1e79c3, d1e79d1, d1e79d3, d1e79e1, d1e79e3, d1e79f1, d1e79f3, d1e79g_, d1e79h1, d1e79h2, d1e79i_

Details for d1e79f2

PDB Entry: 1e79 (more details), 2.4 Å

PDB Description: Bovine F1-ATPase inhibited by DCCD (dicyclohexylcarbodiimide)

SCOP Domain Sequences for d1e79f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1e79f2 b.49.1.1 (F:9-81) N-terminal domain of alpha and beta subunits of F1 ATP synthase {Cow (Bos taurus)}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1e79f2:

Click to download the PDB-style file with coordinates for d1e79f2.
(The format of our PDB-style files is described here.)

Timeline for d1e79f2: